Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G10180.3
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 783aa    MW: 86350.8 Da    PI: 8.3382
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G10180.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ ++LAk+l++te+q+k+WFqN R+k+kk
                      6677899************************************************8 PP

            START   7 aqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                      ++e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is
                      5666777788899999888899999********999553.3589999**************************.******99999********* PP

            START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksngh 161
                      +g      g lqlm aelq++sp vp  d++f+R++ q g g w +vd S+d   + ++         ss  +R   ++llpSg++ie+++ng+
                      ***************************************************98777766653333443222223455899************** PP

            START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      sk+tw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
                      *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.74259119IPR001356Homeobox domain
SMARTSM003891.9E-1761123IPR001356Homeobox domain
CDDcd000865.27E-1862118No hitNo description
PfamPF000464.1E-1763118IPR001356Homeobox domain
CDDcd146864.52E-4110147No hitNo description
PROSITE profilePS5084823.672245502IPR002913START domain
CDDcd088752.61E-90249498No hitNo description
SuperFamilySSF559619.06E-19249497No hitNo description
SMARTSM002342.8E-10261499IPR002913START domain
PfamPF018521.2E-26269497IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650917.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X2
TrEMBLA0A0E0ATG70.0A0A0E0ATG7_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.19e-92HD-ZIP family protein